PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn234881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 276aa    MW: 30754.5 Da    PI: 7.0473
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn234881genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-162974148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T++E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       Achn234881 29 RGSFTEDEEKMIIQLQALLGNK-WAAIASYLP-ERTDNDIKNHWNTHL 74
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.275123IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.5E-10935IPR009057Homeodomain-like
SuperFamilySSF466899.54E-23981IPR009057Homeodomain-like
PROSITE profilePS5129426.1212478IPR017930Myb domain
SMARTSM007172.2E-162876IPR001005SANT/Myb domain
PfamPF002499.9E-162974IPR001005SANT/Myb domain
CDDcd001678.31E-123173No hitNo description
Gene3DG3DSA:1.10.10.603.4E-213679IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MVLGIGGLRR CSKSCRLRWT NYLRPGIKRG SFTEDEEKMI IQLQALLGNK WAAIASYLPE  60
RTDNDIKNHW NTHLKKKLKK LKEPPNGHSM VGFSSPHTIS RGQWEKRLQT DINKAKQALH  120
EALSLEKPSP NVPQLKPSNG YYSFTELKPY NGPAYASSIE NIARLLKGWV KNSTKQAQEN  180
SSTTLNDSVS SEGTQIGPKQ CGVDLSEAFE SLFGFESSNS DFSQSMSPEG SERKPDVGNQ  240
NPLSMLEDWL LDEGGVVQGK EDLANFSFDE DVELF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-20107840108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283575.11e-105PREDICTED: myb-related protein 306
RefseqXP_010661068.11e-105PREDICTED: myb-related protein 306
SwissprotP813922e-74MYB06_ANTMA; Myb-related protein 306
TrEMBLF6H5T61e-105F6H5T6_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g00830.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-61myb domain protein 30